Overview Datasheet
| Category: | Transmembrane Proteins |
| Product Name: | Recombinant Phage shock protein C (pspC) |
| CAT: | TP-2510CY00028 |
| Price: | Inquiry |
Properties
| Species: | Shigella flexneri |
| Expression Region: | 1-119 |
| Protein Length: | Full length |
| Tag Info: | While the tag type is typically selected during our standard production process, we can accommodate specific requirements. Please inform us of your preferred tag, and we will prioritize its development. |
Target
| Target Names: | pspC |
| Target Protein Sequence: | MAGINLNKKLWRIPQQGMVRGVCAGIANYFDVPVKLVRILVVLSIFFGLALFTLVAYIILSFALDPMPDNMAFGEQLPSSSELLDEVDRELAASETRLREMERYVTSDTFTLRSRFRQL |
| Alternative Names: | pspC; SF1311; S1393; Phage shock protein C |
| UniProt ID: | P0AFN5 |
Format
| Formulation: | We typically ship the format currently in stock (liquid or lyophilized). To request a specific format, please add a note to your order, and we will accommodate your request. |
| Buffer: | Tris/PBS-based buffer, 6%Trehalose. |
Instructions
| Reconstitution: | Before opening, briefly centrifuge the vial to collect all contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding glycerol (to a 5-50% final concentration), creating aliquots, and storing them at -20°C or -80°C. As a reference, our default protocol uses a 50% glycerol concentration. |
| Storage: | Store at -20°C or -80°C upon arrival. To preserve activity and avoid repeated freeze-thaw cycles, we strongly recommend aliquoting the product for multiple uses. |
| Shelf Life: | Shelf life can vary based on the protein's stability and storage conditions (e.g., buffer, temperature). Typically, the liquid form is stable for 6 months, and the lyophilized form is stable for 12 months, when stored appropriately at -20°C or -80°C. |
| Shipping: | Please note that delivery times may vary depending on your location and order channel. For a specific delivery estimate, contact your local distributor. All proteins are shipped with standard blue ice packs by default; if you require dry ice, please contact us in advance to arrange this, as an extra fee will apply. |
| Notes: | We advise against repeated freezing and thawing. For daily use, working aliquots may be stored at 4°C for up to one week. |
| Troubleshooting and FAQs: | Protein FAQs |
Please kindly note that our services can only be used to support research purposes (Not for clinical use).
Creative Biolabs is a globally recognized phage company. Creative Biolabs is committed to providing researchers with the most reliable service and the most competitive price.