Overview Datasheet
| Category: | Transmembrane Proteins | 
| Product Name: | Recombinant Escherichia coli Phage shock protein G (pspG) | 
| CAT: | TP-2510CY00005 | 
| Price: | Inquiry | 
Properties
| Species: | Escherichia coli (strain K12) | 
| Expression Region: | 1-80 | 
| Protein Length: | Full length | 
| Tag Info: | While the tag type is typically selected during our standard production process, we can accommodate specific requirements. Please inform us of your preferred tag, and we will prioritize its development. | 
Target
| Target Names: | pspG | 
| Target Protein Sequence: | MLELLFVIGFFVMLMVTGVSLLGIIAALVVATAIMFLGGMLALMIKLLPWLLLAIAVVWVIKAIKAPKVPKYQRYDRWRY | 
| Alternative Names: | pspG; yjbO; b4050; JW5716; Phage shock protein G | 
| UniProt ID: | P32696 | 
Format
| Formulation: | We typically ship the format currently in stock (liquid or lyophilized). To request a specific format, please add a note to your order, and we will accommodate your request. | 
| Buffer: | Tris/PBS-based buffer, 6%Trehalose. | 
Instructions
| Reconstitution: | Before opening, briefly centrifuge the vial to collect all contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding glycerol (to a 5-50% final concentration), creating aliquots, and storing them at -20°C or -80°C. As a reference, our default protocol uses a 50% glycerol concentration. | 
| Storage: | Store at -20°C or -80°C upon arrival. To preserve activity and avoid repeated freeze-thaw cycles, we strongly recommend aliquoting the product for multiple uses. | 
| Shelf Life: | Shelf life can vary based on the protein's stability and storage conditions (e.g., buffer, temperature). Typically, the liquid form is stable for 6 months, and the lyophilized form is stable for 12 months, when stored appropriately at -20°C or -80°C. | 
| Shipping: | Please note that delivery times may vary depending on your location and order channel. For a specific delivery estimate, contact your local distributor. All proteins are shipped with standard blue ice packs by default; if you require dry ice, please contact us in advance to arrange this, as an extra fee will apply. | 
| Notes: | We advise against repeated freezing and thawing. For daily use, working aliquots may be stored at 4°C for up to one week. | 
| Troubleshooting and FAQs: | Protein FAQs | 
Please kindly note that our services can only be used to support research purposes (Not for clinical use).
Creative Biolabs is a globally recognized phage company. Creative Biolabs is committed to providing researchers with the most reliable service and the most competitive price.