Products

Online inquiry

  •  

Contact us

Recombinant Enterobacteria phage PRD1 Protein P35 (XXXV)

Overview Datasheet

Category:  Transmembrane Proteins
Product Name: Recombinant Enterobacteria phage PRD1 Protein P35 (XXXV)
CAT: TP-2510CY00024
Price: Inquiry

Properties

Species: Enterobacteria phage PRD1 (Bacteriophage PRD1)
Expression Region: 1-117
Protein Length: Full length
Tag Info: While the tag type is typically selected during our standard production process, we can accommodate specific requirements. Please inform us of your preferred tag, and we will prioritize its development.

Target

Target Names: XXXV
Target Protein Sequence: MMENDEWWKYLIFPLVATLGGIVNYSKRALAMKRFSKLEFAVEAVSAAFVGLMVTLGGAAMDLSPHWLGMAAGMSGWMGADFVKAVFSQFVQSKIAPINQPGPIDSDNDKPGRTFND
Alternative Names: XXXV; Holin; Protein P35
UniProt ID: Q3T4L9

Format

Formulation: We typically ship the format currently in stock (liquid or lyophilized). To request a specific format, please add a note to your order, and we will accommodate your request.
Buffer: Tris/PBS-based buffer, 6%Trehalose.

Instructions

Reconstitution: Before opening, briefly centrifuge the vial to collect all contents at the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding glycerol (to a 5-50% final concentration), creating aliquots, and storing them at -20°C or -80°C. As a reference, our default protocol uses a 50% glycerol concentration.
Storage: Store at -20°C or -80°C upon arrival. To preserve activity and avoid repeated freeze-thaw cycles, we strongly recommend aliquoting the product for multiple uses.
Shelf Life: Shelf life can vary based on the protein's stability and storage conditions (e.g., buffer, temperature). Typically, the liquid form is stable for 6 months, and the lyophilized form is stable for 12 months, when stored appropriately at -20°C or -80°C.
Shipping: Please note that delivery times may vary depending on your location and order channel. For a specific delivery estimate, contact your local distributor. All proteins are shipped with standard blue ice packs by default; if you require dry ice, please contact us in advance to arrange this, as an extra fee will apply.
Notes: We advise against repeated freezing and thawing. For daily use, working aliquots may be stored at 4°C for up to one week.
Troubleshooting and FAQs: Protein FAQs

Please kindly note that our services can only be used to support research purposes (Not for clinical use).

Biophage Technology

Creative Biolabs is a globally recognized phage company. Creative Biolabs is committed to providing researchers with the most reliable service and the most competitive price.

Contact Us
  • Global Locations
Privacy Policy | Cookie Policy | Copyright © 2026 Creative Biolabs. All rights reserved.